PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A10G1496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 354aa    MW: 39518.4 Da    PI: 5.4728
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A10G1496genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.62.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEde+l++++k+ G g+W++ ++  g+ R++k+c++rw +yl
      Gh_A10G1496 14 KGRWTAEEDEILANYIKENGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding482.8e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T++E+e +v+ +  lG++ W+ Ia+ ++ gRt++++k++w+++l
      Gh_A10G1496  67 RGNITADEEETIVKFHSALGNR-WSFIAAQLP-GRTDNEIKNYWNSHL 112
                      7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-22564IPR009057Homeodomain-like
PROSITE profilePS5129416.635961IPR017930Myb domain
SuperFamilySSF466891.96E-2711108IPR009057Homeodomain-like
SMARTSM007172.2E-121363IPR001005SANT/Myb domain
PfamPF002492.6E-151461IPR001005SANT/Myb domain
CDDcd001671.89E-91661No hitNo description
PROSITE profilePS5129423.89262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2365116IPR009057Homeodomain-like
SMARTSM007173.2E-1466114IPR001005SANT/Myb domain
PfamPF002493.3E-1367112IPR001005SANT/Myb domain
CDDcd001675.26E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MGRSPCCEKV GLKKGRWTAE EDEILANYIK ENGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNI TADEEETIVK FHSALGNRWS FIAAQLPGRT DNEIKNYWNS HLSRKIYSFS  120
KTIKETKPTD LDAIKTAEDH QRKRRCGRTS RSAMKRQKLA LMSLGISKTV TPNAQESSHG  180
ETLEMHGSCM HSNAAGQPQG NYDESGSNGG RALSTNSGEE SSGDGIENEV LLGPYEWLDN  240
EIKRLSCILQ RSQGADPSGN HGGVVDSVNG VIKDTQNDAR ERESYGIGSS SSNTTEITDH  300
HGDEWQMCNS SVDFIGDFQW CDDHQWELSW DDLEKAFCWS WDDANGDDEA GKNT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-23121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4591407e-66AJ459140.1 Gossypium hirsutum partial myb114 gene, clone pGhMYB114.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012457553.10.0PREDICTED: transcription factor MYB12
TrEMBLA0A0D2UVT10.0A0A0D2UVT1_G
STRINGPOPTR_0010s15090.14e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.11e-77myb domain protein 111